Immunomodulating drugs

Specificity Recognizes Brn-3a. Shows no reactivity to Brn-3b or Brn-3c by Western blot.

General description Anti-BRP16 Antibody detects endogenous levels of total BRP16 protein. Immunogen The antiserum was produced against synthesized peptide derived from human BRP16.

General description Anti-BRP44 Antibody detects endogenous levels of total BRP44 protein. Immunogen The antiserum was produced against synthesized peptide derived from human BRP44.

Immunogen Synthetic peptide directed towards the N terminal region of human BRPF3 Application Rabbit Anti-BRPF3 antibody is suitable for western blot applications at a concentration of 1&#956g/ml. Sequence Synthetic peptide located within the

General description Anti-BRS3 Antibody detects endogenous levels of total BRS3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human BRS3.

Immunogen BRSK1 antibody was raised against a 28 amino acid peptide from near the carboxy terminus of human BRSK1. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen BRSK2 (AAH24291.1, 1 a.

General description Btk (Bruton&#8217:s tyrosine kinase also known as BPK or ATK) is a member of the TEC family of non-receptor protein tyrosine kinase which includes Bmx, Itk and TEC. BTK plays a crucial role in B cell activation and development.

Specificity BSA Immunogen Fraction V bovine serum albumin Application Research Category Epitope Tags &amp: General Use Research Sub Category Epitope Tags This Anti-Albumin Antibody is an antibody against BSA (Bovine Serum Albumin) for use in

Immunogen BSD domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

General description The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the

Immunogen Recombinant protein corresponding to barttin CLCNK type accessory beta subunit Sequence QPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACS Application All Prestige Antibodies Powered by Atlas Antibodies