Immunomodulating drugs

Immunogen Synthetic peptide directed towards the N terminal region of human BCKDHA Sequence Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY Physical form Purified antibody supplied in

Immunogen branched chain keto acid dehydrogenase E1, beta polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

Branched chain ketoacid dehydrogenase kinase (BCKDK) is highly expressed in the skeletal muscles and the gene encoding it is located on human chromosome 16p11.2.

Immunogen Bcl10 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Bcl10. Features and Benefits Evaluate our antibodies with complete peace of mind.

Specificity Bcl-2 Immunogen KLH-conjugated, synthetic peptide corresponding to amino acids 41-54 (C-GAAPAPGIFSSQPG) of human Bcl-2 Application Research Category Apoptosis &amp: Cancer Research Sub Category BCL2 &amp: Inhibition This

General description This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy

General description B-cell lymphoma 2 (BCL-2) is an anti-apoptotic and target gene of nuclear factor-&#954:B (NF-&#954:B). The protein is expressed in the nuclear envelope, mitochondria and endoplasmic reticulum.

General description B-cell lymphoma 2 (BCL-2) is an integral inner mitochondrial membrane protein that acts as an antiapoptotic protein. It is a target gene of nuclear factor kappa B (NF-kB).

Polyclonal antibody for Bcl-2/BCL2 detection. Host: Rabbit.

General description B cell lymphoma 6 protein (Bcl-6) proto-oncogene product (a Kruppel-type zinc-finger protein) is mainly expressed in normal germinal center B cells and related lymphomas. Bcl-6 is involved in chromosome rearrangements at 3q27

Immunogen a 16 amino acid peptide from near the amino-terminus of human Bcl-B. Linkage The action of this antibody can be blocked using blocking peptide SBP3163 .