-
Add to Cart The item has been addedSAB2103826-100ULANTI-BTN2A1 (C15-1744-692)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human BTN2A1 Biochem/physiol Actions This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is -
Add to Cart The item has been addedHPA012565-100ULANTI-BTN3A1 (C15-1447-798)
Price: $1,118.92List Price: $1,243.24Immunogen Butyrophilin subfamily 3 member A1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedSAB1400419-50UGANTI-BTN3A2 ANTIBODY PRODUCED IN MOUSE
Price: $980.46List Price: $1,089.40General description This gene encodes a member of the immunoglobulin superfamily, containing two Ig domains with similarity to Ig variable and Ig constant domains. The gene resides in the juxta-telomeric region of the major histocompatability -
Add to Cart The item has been addedHPA011871-100ULANTI-BTN3A3 (C15-1447-657)
Price: $959.88List Price: $1,066.53Immunogen Butyrophilin subfamily 3 member A3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedSAB2103284-100ULANTI-BTNL3
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human BTNL3 Sequence Synthetic peptide located within the following region: EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI Physical form Purified antibody supplied in -
Add to Cart The item has been addedHPA039738-100ULANTI-BTNL8 ANTIBODY PRODUCED IN RABBIT (C15-1455-880)
Price: $1,013.20List Price: $1,125.78The butyrophilin like 8 (BTNL8) gene spanning ~52kb with eight exons is mapped to human chromosome 5q35.3. -
Add to Cart The item has been addedSAB3500443-100UGANTI-BUB3 ANTIBODY PRODUCED IN RABBIT (C15-1741-130)
Price: $987.94List Price: $1,097.71Immunogen Bub3 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human bub3. Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedHPA003601-100Anti-BUB3 BUB3 mitotic checkpoint protein, 100ul UN 1687 6.1
Price: $1,045.96List Price: $1,162.18Anti-BUB3 BUB3 mitotic checkpoint protein, 100ul UN 1687 6.1 -
Add to Cart The item has been addedHPA003601-25Anti-BUB3 BUB3 mitotic checkpoint protein, 25ul UN 1687 6.1
Price: $745.62List Price: $828.46Anti-BUB3 BUB3 mitotic checkpoint protein, 25ul UN 1687 6.1 -
Add to Cart The item has been addedSAB1401884-50UGANTI-BXDC1 ANTIBODY PRODUCED IN MOUSE
Price: $980.46List Price: $1,089.40Immunogen BXDC1 (NP_115570.1, 1 a. -
Add to Cart The item has been addedHPA031217-100ULANTI-BYSL (C15-1453-035)
Price: $970.54List Price: $1,078.38Immunogen bystin-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA031219-100ULANTI-BYSL (C15-1453-036)
Price: $970.54List Price: $1,078.38Immunogen bystin-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
