-
Add to Cart The item has been addedSAB1303261-400ULANTI-C10ORF47 (N-TERM)
Price: $900.00List Price: $1,000.00Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been addedHPA037951-100ULANTI-C10ORF53
Price: $1,013.20List Price: $1,125.78Immunogen UPF0728 protein C10orf53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA045739-100ULANTI-C10ORF55 ANTIBODY PRODUCED IN RABBIT
Price: $1,066.53List Price: $1,185.03Immunogen chromosome 10 open reading frame 55 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedSAB2100237-100ULANTI-C10ORF56
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human C10orf56 Sequence Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedHPA038131-100ULANTI-C10ORF67 (C15-1455-080)
Price: $1,013.20List Price: $1,125.78Immunogen Uncharacterized protein C10orf67 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA050913-100ULANTI-C10ORF76 ANTIBODY PRODUCED IN RABBIT (C15-1460-451)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 10 open reading frame 76 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA053580-100ULANTI-C10ORF76 ANTIBODY PRODUCED IN RABBIT (C15-1461-385)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 10 open reading frame 76 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedAV53380-100ULANTI-C10ORF83
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human C10orf83 Biochem/physiol Actions The exact function of C10orf83 remains unknown. Sequence Synthetic peptide located within the following region: -
Add to Cart The item has been addedHPA039681-100ULANTI-C10ORF88 (C15-1455-843)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 10 open reading frame 88 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA040991-100ULANTI-C10ORF88 (C15-1456-462)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 10 open reading frame 88 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA038648-100ULANTI-C10ORF90 (C15-1455-367)
Price: $1,013.20List Price: $1,125.78Immunogen Uncharacterized protein C10orf90 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedSAB1400711-50UGANTI-C10ORF97 ANTIBODY PRODUCED IN MOUSE
Price: $980.46List Price: $1,089.40General description C10ORF97 is a member of the caspase-associated recruitment domain (CARD) family of proteins that play a role in apoptosis (Liu et al., 2002 [PubMed 12054670]).
