Immunomodulating drugs

Physical form Supplied in PBS with 0.09% (W/V) sodium azide Disclaimer Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for

Immunogen Protein bicaudal D homolog 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Bid, a BH3 domain-containing proapoptotic Bcl-2 family member, is known to interact with Bcl-2 and Bax. It has been reported that Bid induces cytochrome c release from mitochondria following cleavage by caspase-8 in response to apoptotic stimuli

General description The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities.

General description Anti-BIM Antibody detects endogenous levels of total BIM protein. Immunogen The antiserum was produced against synthesized peptide derived from human BIM.

Immunogen Myc box-dependent-interacting protein 1 recombinant protein epitope signature tag (PrEST) Sequence SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP Application All Prestige

Immunogen The immunogen for anti-BIN1 antibody: synthetic peptide directed towards the N terminal of human BIN1 Sequence Synthetic peptide located within the following region: SKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQL Physical form

Immunogen bridging integrator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen bridging integrator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Bridging integrator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Nano-activeGold&trade can be used in immunoblotting, light microscopy, and electron microscopy to provide clear visibility. Smallest commercially available gold immunoprobes.

Nano-activeGold&trade can be used in immunoblotting, light microscopy, and electron microscopy to provide clear visibility. Smallest commercially available gold immunoprobes.