Immunomodulating drugs

Immunogen bromodomain PHD finger transcription factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen bromodomain PHD finger transcription factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Peptide with sequence KVWELYKQCTPK from the internal region of the protein sequence according to NP_000701.2.

B-Raf proto-oncogene serine/threonine-protein kinase (BRAF) is involved in the regulation of MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Defective BRAF is associated with cardiofaciocutaneous

Specificity Reacts with proBDNF. Does not recognize mature BDNF isoforms.

Immunogen HEAT repeat-containing protein C7orf27 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to BRCA1, DNA repair associated Sequence GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

General description Anti-BRCA1 (Ab-1), mouse monoclonal, clone MS110, recognizes the ~220 kDa BRCA1 protein in MCF-7 cells. It is validated for WB, IF, IP, and frozen and paraffin sections.

General description BRCA1 (breast cancer 1) is a tumor suppressor gene, that is located on human chromosome 17q21. It has an N-terminal RING (really interesting new gene) domain, a negatively charged region in its C terminus, and C-terminal

General description Anti-BRCA1 (Ab-2), mouse monoclonal, clone MS13, recognizes ~220 kDa BRCA1 in MCF-7 cells. It is validated for Western blotting, immunofluorescence, immunoprecipitation, and for paraffin sections.

General description Anti-BRCA1 (Ab-4), mouse monoclonal, clone SD118, recognizes the ~220 kDa BRCA1 in HBL-100 and SK-BR3 cells. It is validated for WB, IF, IP, and for frozen sections.

Specificity The breast cancer susceptibility gene, BRCA1*, is located on chromosome 17 (at q21), and is mutated in the majority of heritable breast cancers. The mutations within the coding region occur throughout the gene with little apparent