Immunomodulating drugs

Immunogen 2,3-bisphosphoglycerate mutase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the middle region of human BPGM Sequence Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK Physical form Purified antibody supplied in 1x PBS

Specificity The antibody detects endogenous level of total BPIFB1 protein. Immunogen Synthetic peptide corresponding to a region derived from 140-153 amino acids of Human BPI fold containing family B, member 1 Features and Benefits Evaluate

Immunogen BPI fold containing family B, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen BPI fold containing family B, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen bactericidal/permeability-increasing protein-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

General description BPIL1 is a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) family. This protein is highly expressed in hypertrophic tonsils.

Immunogen bromodomain PHD finger transcription factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen bromodomain PHD finger transcription factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Peptide with sequence KVWELYKQCTPK from the internal region of the protein sequence according to NP_000701.2.

B-Raf proto-oncogene serine/threonine-protein kinase (BRAF) is involved in the regulation of MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Defective BRAF is associated with cardiofaciocutaneous

Specificity Reacts with proBDNF. Does not recognize mature BDNF isoforms.