Immunomodulating drugs

The gene BTBD17 (BTB domain containing 17) is mapped to human chromosome 17. It is downregulated in astrocytes of mice with Alzheimer′s disease.

Immunogen BTB (POZ) domain containing 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BTB (POZ) domain containing 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the C terminal region of human BTBD3 Biochem/physiol Actions BTBD3 is a protein containing BTB/POZ domain. Sequence Synthetic peptide located within the following region:

Immunogen BTB (POZ) domain containing 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the middle region of human BTBD6 Sequence Synthetic peptide located within the following region: GKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS Physical form Purified antibody supplied in 1x

Immunogen BTB (POZ) domain containing 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BTB domain containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen BTB domain containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen BTB (POZ) domain containing 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen basic transcription factor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

General description Anti-BTF3L4 Antibody detects endogenous levels of total BTF3L4 protein. Immunogen The antiserum was produced against synthesized peptide derived from human BTF3L4.