-
Add to Cart The item has been addedHPA029339-100ULANTI-C5 (C15-1452-229)
Price: $959.88List Price: $1,066.53Immunogen complement component 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedSAB4500201-100UGANTI-C56D2 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-C56D2 Antibody detects endogenous levels of total C56D2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human C56D2. -
Add to Cart The item has been addedHPA014520-100ULANTI-C5AR1 (C15-1448-171)
Price: $959.88List Price: $1,066.53C5AR1 (complement component 5a receptor 1) is a G-protein coupled receptor (GPCR) belonging to the rhodopsin family. It is expressed in myeloid-lineage blood cells, as well as non-myeloid cells such as epithelial cells of bronchi and alveolus, and -
Add to Cart The item has been addedHPA039165-100ULANTI-C5ORF15 (C15-1455-605)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 5 open reading frame 15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043062-100ULANTI-C5ORF22 (C15-1457-507)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 5 open reading frame 22 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA059946-100ULANTI-C5ORF28 (C15-1463-423)
Price: $1,013.20List Price: $1,125.78Immunogen transmembrane protein 267 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043975-100ULANTI-C5ORF45 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen MRN complex interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043823-100ULANTI-C6 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen complement component 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA037660-100ULANTI-C6ORF1 (C15-1454-830)
Price: $1,013.20List Price: $1,125.78Immunogen Uncharacterized protein C6orf1 Precursor (Protein LBH) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA034489-100ULANTI-C6ORF106 (C15-1453-416)
Price: $970.54List Price: $1,078.38Immunogen Uncharacterized protein C6orf106 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedSAB2100306-100ULANTI-C6ORF113
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human C6orf113 Sequence Synthetic peptide located within the following region: RQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRMPPSEFHRRKAD Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedHPA029787-100ULANTI-C6ORF118 (C15-1452-413)
Price: $959.88List Price: $1,066.53Immunogen Uncharacterized protein C6orf118 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
