-
Add to Cart The item has been addedHPA029789-100ULANTI-C6ORF118 (C15-1452-414)
Price: $959.88List Price: $1,066.53Immunogen Uncharacterized protein C6orf118 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA039626-100ULANTI-C6ORF120 (C15-1455-828)
Price: $1,013.20List Price: $1,125.78Immunogen UPF0669 protein C6orf120 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA044588-100ULANTI-C6ORF132 (C15-1458-207)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 6 open reading frame 132 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedSAB2100308-100ULANTI-C6ORF134 (C15-1745-539)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human C6orf134 Sequence Synthetic peptide located within the following region: DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedHPA001436-100ULANTI-C6ORF15 (C15-1445-283)
Price: $959.88List Price: $1,066.53Immunogen Uncharacterized protein C6orf15 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA044797-100ULANTI-C6ORF163 ANTIBODY PRODUCED IN RABBIT (C15-1458-280)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 6 open reading frame 163 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedSAB1400649-50UGANTI-C6ORF210 ANTIBODY PRODUCED IN MOUSE
Price: $980.46List Price: $1,089.40General description The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 -
Add to Cart The item has been addedHPA038407-100ULANTI-C6ORF222 (C15-1455-234)
Price: $1,013.20List Price: $1,125.78Immunogen Uncharacterized protein C6orf222 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA073017-100ULANTI-C6ORF25 (C15-1466-299)
Price: $1,013.20List Price: $1,125.78Immunogen megakaryocyte and platelet inhibitory receptor G6b recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA036263-100ULANTI-C6ORF58
Price: $1,013.20List Price: $1,125.78Immunogen UPF0762 protein C6orf58 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedSAB1302879-400ULANTI-C6ORF58 (CENTER)
Price: $900.00List Price: $1,000.00Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been addedHPA030564-100ULANTI-C6ORF62 (C15-1452-752)
Price: $959.88List Price: $1,066.53Immunogen Uncharacterized protein C6orf62 (HBV X-transactivated gene 12 protein) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
