Immunomodulating drugs

Immunogen Synthetic peptide directed towards the middle region of human C9orf46 Sequence Synthetic peptide located within the following region: GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK Physical form Supplied at 0.5 mg/ml in

Immunogen Uncharacterized protein C9orf66 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Chromosome 9 open reading frame 72 (C9orf72) gene is mapped to human chromosome 9p21. The gene codes for a highly conserved uncharacterized protein.

Immunogen Synthetic peptide directed towards the middle region of human C9orf75 Sequence Synthetic peptide located within the following region: EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY Physical form Purified antibody supplied in 1x

General description Anti-C9ORF89 Antibody detects endogenous levels of total C9ORF89 protein. Immunogen The antiserum was produced against synthesized peptide derived from human C9orf89.

Immunogen transmembrane protein 268 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Carbonic anhydrase 14 (CA14) is a metalloenzyme, which is localized in the brain. It belongs to the &#945-CA gene family and the gene encoding it is present on the chromosome 1q21.

Immunogen Carbonic anhydrase 2 recombinant protein epitope signature tag (PrEST) Application Anti-CA2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by

Carbonic anhydrase III (CA3) is a member of a multi-gene CA family that encodes carbonic anhydrase isozymes and termed as Car3 and CAIII. The expression of isoform has shown an increased abundance during muscle aging and is relatively muscle

CA4 (carbonic anhydrase IV) is a 35kDa glycosylphosphatidylinositol-anchored membrane protein belonging to the zinc metalloprotein family. It is synthesized as a precursor of 312 amino acids, in endoplasmic reticulum and resides in the plasma

General description Anti-CA5A Antibody detects endogenous levels of total CA5A protein. Immunogen The antiserum was produced against synthesized peptide derived from human CA5A.

Immunogen carbonic anhydrase VII recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported