Immunomodulating drugs

ANTI-CARS ANTIBODY CLONE 7V0X1 RABBIT MONOCLONAL

Immunogen cysteinyl-tRNA synthetase 2, mitochondrial (putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Full length fusion protein of human CARTPT Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

General description Strep-Tag is a short amino acid-peptide sequence that exhibits specific binding to streptavidin. It is shown to reversibly occupy the same pocket where biotin is normally complexed.

General description Strep-Tag is a short amino acid-peptide sequence that exhibits specific binding to streptavidin. It is shown to reversibly occupy the same pocket where biotin is normally complexed.

Physical form Supplied in PBS with 0.09% (W/V) sodium azide Disclaimer Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for

Immunogen Synthetic peptide directed towards the N terminal region of human CASD1 Sequence Synthetic peptide located within the following region: MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE Physical form Purified antibody supplied in

Immunogen Peptide with sequence C-DREERLRHSRNPATR from the internal region of the protein sequence according to NP_001884.2: NP_620693.

Casein Kinase 2 (CK2) is a ubiquitously expressed serine/threonine kinase that has been implicated in various cellular functions such as cell death, cell cycle regulation, and mRNA synthesis. This protein kinase comprises of two catalytic &#945

General description Anti-Casein Kinase II &#945: Antibody detects endogenous levels of total Casein Kinase II &#945: protein. Casein kinase II &#945: (CK2) is a pleiotropic serine/threonine kinase, that is located on human chromosome 16p13.

Immunogen Fusion protein of human CASK Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Specificity CASK. The immunogen protein represents a CASK-specific domain that lies between the calmodulin binding and PDZ domains.