Immunomodulating drugs

Immunogen Synthetic peptide directed towards the N terminal region of human CASD1 Sequence Synthetic peptide located within the following region: MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE Physical form Purified antibody supplied in

Immunogen Peptide with sequence C-DREERLRHSRNPATR from the internal region of the protein sequence according to NP_001884.2: NP_620693.

Casein Kinase 2 (CK2) is a ubiquitously expressed serine/threonine kinase that has been implicated in various cellular functions such as cell death, cell cycle regulation, and mRNA synthesis. This protein kinase comprises of two catalytic &#945

General description Anti-Casein Kinase II &#945: Antibody detects endogenous levels of total Casein Kinase II &#945: protein. Casein kinase II &#945: (CK2) is a pleiotropic serine/threonine kinase, that is located on human chromosome 16p13.

Immunogen Fusion protein of human CASK Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Specificity CASK. The immunogen protein represents a CASK-specific domain that lies between the calmodulin binding and PDZ domains.

Immunogen CASK interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Anti-CASKIN1 CASK interacting protein 1, 25ul UN 1687 6.1 PG

Anti-CASKIN1 CASK interacting protein 1, 25ul UN 1687 6.1 PG

Immunogen Antibody was raised against a 19 amino acid peptide near the amino terminus of human CASKIN2. Features and Benefits Evaluate our antibodies with complete peace of mind.

Anti-CASKIN2 CASK interacting protein 2, 25ul UN 1687 6.1 PG

Anti-CASKIN2 CASK interacting protein 2, 25ul UN 1687 6.1 PG