Immunomodulating drugs

Immunogen Recombinant protein corresponding to calpain small subunit 2 Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Recombinant protein corresponding to calpain small subunit 2 Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Cell cycle associated protein 1 (CAPRIN1) gene is mapped to human chromosome 11p13. The gene codes for highly conserved cytoplasmic phosphoprotein.

Immunogen cell cycle associated protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen caprin family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen calcyphosine recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen a 20 amino acid peptide near the carboxy-terminus of the human CAPS1. Linkage The action of this antibody can be blocked using blocking peptide SBP4559 .

Immunogen a 21 amino acid peptide near the amino-terminus of the human CAPS1. Linkage The action of this antibody can be blocked using blocking peptide SBP4561 .

Immunogen calcyphosine 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen F-actin-capping protein subunit alpha-2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen capping protein (actin filament) muscle Z-line, alpha 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen capping protein (actin filament) muscle Z-line, alpha 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most