Immunomodulating drugs

This antibody has been tested for use in ELISA, IHC, IF, and western blotting. This antiserum detects endogenous Casz1 proteins, both the hCasz5 and hCasz11 isoforms.

Immunogen Synthetic peptide directed towards the middle region of human CAT Sequence Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG Physical form Purified antibody supplied in 1x PBS

This product has been assayed against 1.0 ug of Cat IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at room temperature.

This product has been assayed against 1.0 ug of Cat IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at room temperature.

General description An immunoglobulin has two heavy chain and two light chain connected by disulfide bond. It mainly helps in immune defense.

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Cat IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Cat IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis

IgG&nbspis present in large quantities in the human serum. It constitutes about 10-20% of the plasma proteins.

This product has been assayed against 1.0 ug of Cat IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at

This product has been assayed against 1.0 ug of Cat IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at

This product has been assayed against 1.0 ug of Cat IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at room temperature.

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Cat IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis