Immunomodulating drugs

Immunogen Peptide with sequence C-KFDASQKKSAKEKR from the internal region of the protein sequence according to NP_033957.1.

General description Anti-CCKBR Antibody detects endogenous levels of total CCKBR protein. Immunogen The antiserum was produced against synthesized peptide derived from human CCKBR.

Immunogen chemokine (C-C motif) ligand 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the middle region of human CCL8 Sequence Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP Physical form Purified antibody supplied in 1x PBS

Immunogen cerebral cavernous malformation 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Cerebral cavernous malformation 2-like (CCM2L) is expressed in endothelial cells during cardiovascular growth. It contains a PTB domain comprising of amino acids 45–146 that contains a long insertion between the &#9466 and &#9467 sheets.

Immunogen cerebral cavernous malformation 2-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CCN1 (cysteine-rich 61 or CYR61), a ubiquitous angiogenic factor, is a member of the CNN family, which is also comprised of CTGF, WISP-1, WISP-2, and WISP-3. It is a multidomain protein, containing one each of CTCK, IGFBP, TSP type-1, and VWFC

G2/mitotic-specific cyclin-B1 (CCNB1), also known as cyclin B1, regulates cell division in eukaryotes. It has N-terminal and C-terminal cyclin box motifs.

CCNB2 (cyclin B2) is localized to human chromosome 15q22.2.

Immunogen cyclin D2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen cyclin D-type binding-protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in