Immunomodulating drugs

Specificity This antibody reacts to human CD23. Immunogen A peptide corresponding to C-terminus of human CD23 Physical form Solution in phosphate buffered saline containing 50% Glycerol/PBS with 1% BSA and 0.

Immunogen Recombinant protein corresponding to CD24 molecule Sequence TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Specificity The antibody reacts with the CD24 antigen a heavily glycosylated molecule that migrates as a broad band of 35-45 kDa on both reducing and non-reducing SDS gel electrophoresis. CD24 is attached to the cell membrane via a glycosyl

General description Natural killer (NK) cells express both activating and inhibitory cell surface receptors. Inhibitory signaling receptors all possess cytoplasmic immunoreceptor tyrosine-based inhibitory motifs, or ITIMs, whereas the activating

Immunogen CD248 molecule, endosialin recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunofluorescence (1

Immunogen CD248 (AAI04485.1, 1 a.

Specificity This antibody reacts to Interleukin-2 receptor subunit alpha (CD25). Immunogen A peptide corresponding to the N-terminus of human CD25 Physical form Solution in phosphate buffered saline containing 50% Glycerol/PBS with 1% BSA

Anti-CD25 is useful for Flow Cytometry. Researchers should determine optimal titers for applications that are not stated.

Anti-CD25 is useful for Flow Cytometry using mouse spleen cells, or an appropriate cell type (where indicated). Researchers should determine optimal titers for applications that are not stated.

General description IL2RA (interleukin 2 receptor subunit &#945:) gene codes for interleukin-2 receptor &#945:-chain CD25. CD25 is expressed on activated T-cells.

General description The BC96 antibody is specific for human CD25, a 55 kDa surface protein also known as the Interleukin-2 Receptor alpha chain, or IL-2R alpha. CD25 may bind IL-2 by itself, altho&#181:gh with low affinity and without induction of

General description The BC96 antibody is specific for human CD25, a 55 kDa surface protein also known as the Interleukin-2 Receptor alpha chain, or IL-2R alpha. CD25 may bind IL-2 by itself, altho&#181:gh with low affinity and without induction of