Immunomodulating drugs

Immunogen cell division cycle 27 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

ANTI-CDC27 ANTIBODY CLONE 7U5A3 RABBIT MONOCLONAL

Monoclonal Anti-Cdc27 (mouse IgG2b isotype) is derived from the AF3.1 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from a BALB/c mouse immunized with a synthetic peptide corresponding to C-terminal of human Cdc27,

Immunogen Synthetic peptide directed towards the N terminal region of human CDC42 Sequence Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP Physical form Purified antibody supplied in

General description The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression.

Anti-CDC42BPB CDC42 binding protein kinase beta (DMPK-like),

Anti-CDC42BPB CDC42 binding protein kinase beta (DMPK-like),

Immunogen CDC42 effector protein (Rho GTPase binding) 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CDC42 effector protein (Rho GTPase binding) 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CDC42 effector protein (Rho GTPase binding) 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

General description The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a

General description Anti-CDC6 Antibody detects endogenous levels of total CDC6 protein. Immunogen The antiserum was produced against synthesized peptide derived from human CDC6.