Immunomodulating drugs

General description Anti-CDC6 Antibody detects endogenous levels of total CDC6 protein. Immunogen The antiserum was produced against synthesized peptide derived from human CDC6.

General description Anti-CDC7 Antibody detects endogenous levels of total CDC7 protein. Immunogen The antiserum was produced against synthesized peptide derived from human CDC7.

Anti-Cdc7 Kinase antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the DCS-341 hybridoma produced by the fusion of mouse myeloma cells (NS2) and splenocytes from BALB/c mice immunized with full length human Cdc7 kinase. Cell division

Immunogen Synthetic peptide directed towards the middle region of human CDCA5 Sequence Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST Physical form Purified antibody supplied in 1x

Immunogen A synthesized peptide derived from human CDCA5 Physical form Buffer: PBS with 0.02% sodium azide,0.

General description Anti-CDCA7 Antibody detects endogenous levels of total CDCA7 protein. Immunogen The antiserum was produced against synthesized peptide derived from human CDCA7.

Immunogen Cell division cycle-associated 7-like protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

General description CDCA8 is a component of a chromosomal passenger complex required for stability of the bipolar mitotic spindle (Gassmann et al., 2004 [PubMed 15249581]).

General description CDCA8 is a component of the chromosomal passenger complex (CPC) required for stability of the bipolar mitotic spindle. The CPC complex, a key regulator of mitosis, has essential functions at the centromere in ensuring correct

CUB-domain-containing protein 1 (CDCP1) is a type I transmembrane protein which functions as a substrate for Src kinases. It has a molecular weight of 140kDa, and has a proteolytically cleaved form of molecular weight 85kDa.

Immunogen Peptide with sequence C-PLLNTQEPMEPAE from the C Terminus of the protein sequence according to NP_073753.3.

General description Anti-CDCP1 Antibody detects endogenous levels of total CDCP1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human CDCP1.