-
HPA022032-100UL
ANTI-ABCA5 (C005B-205803)
Price: $959.88List Price: $1,066.53ABCA5 (ATP binding cassette subfamily A member 5) is a member of ATP-binding cassette subfamily A (ABCA) transporters. It is highly expressed in several location of human brain such as neurons, moderately in microglia and at a lesser amount in -
HPA013859-100UL
ANTI-ALOX15 (C005B-203874)
Price: $959.88List Price: $1,066.53The gene ALOX15 (Arachidonate 15-lipoxygenase) is mapped to human chromosome 17p13.3. -
HPA076616-100UL
ANTI-ATL3 (C005B-222124)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to atlastin GTPase 3 Sequence NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA025037-100UL
ANTI-CNBD1 (C005B-206621)
Price: $959.88List Price: $1,066.53Immunogen cyclic nucleotide binding domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA025240-100UL
ANTI-CNPY4 (C005B-206645)
Price: $959.88List Price: $1,066.53The gene CNPY4 (canopy FGF signaling regulator 4) is mapped to human chromosome 7q22.1. -
HPA023594-100UL
ANTI-CTBS (C005B-206171)
Price: $959.88List Price: $1,066.53The gene CTBS (chitobiase) is mapped to human chromosome 1p22. The gene spans a length of approximately 20kb with seven exons interspaced by six introns. -
HPA074117-100UL
ANTI-CUZD1 (C005B-221723)
Price: $1,013.20List Price: $1,125.78Immunogen CUB and zona pellucida-like domains 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA010641-100UL
ANTI-CYB5R1 (C005B-203302)
Price: $959.88List Price: $1,066.53Immunogen NAD(P)H:quinone oxidoreductase type 3, polypeptide A2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA038962-100UL
ANTI-CYB5R2 (C005B-211041)
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome b5 reductase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA061707-100UL
ANTI-CYB5R2 (C005B-219154)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to cytochrome b5 reductase 2 Sequence NQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA060463-100UL
ANTI-CYB5RL (C005B-218820)
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome b5 reductase-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA068255-100UL
ANTI-DEFB136 (C005B-220691)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to defensin beta 136 Sequence GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas