Basiliximab

ABCA5 (ATP binding cassette subfamily A member 5) is a member of ATP-binding cassette subfamily A (ABCA) transporters. It is highly expressed in several location of human brain such as neurons, moderately in microglia and at a lesser amount in

The gene ALOX15 (Arachidonate 15-lipoxygenase) is mapped to human chromosome 17p13.3.

Immunogen Recombinant protein corresponding to atlastin GTPase 3 Sequence NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen cyclic nucleotide binding domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

The gene CNPY4 (canopy FGF signaling regulator 4) is mapped to human chromosome 7q22.1.

The gene CTBS (chitobiase) is mapped to human chromosome 1p22. The gene spans a length of approximately 20kb with seven exons interspaced by six introns.

Immunogen CUB and zona pellucida-like domains 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen NAD(P)H:quinone oxidoreductase type 3, polypeptide A2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen cytochrome b5 reductase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to cytochrome b5 reductase 2 Sequence NQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen cytochrome b5 reductase-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to defensin beta 136 Sequence GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas