-
Add to Cart The item has been addedHPA020071-100ULANTI-DUSP8 (C15-1449-510)
Price: $959.88List Price: $1,066.53The gene encoding dual specificity protein phosphatase 8 (DUSP8) is localized on human chromosome 11p15.5. -
Add to Cart The item has been addedHPA020593-100ULANTI-EPHX1 (C15-1449-645)
Price: $959.88List Price: $1,066.53Immunogen epoxide hydrolase 1, microsomal (xenobiotic) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA018910-100ULANTI-ETFB (C15-1449-136)
Price: $959.88List Price: $1,066.53The gene electron transfer flavoprotein subunit β (ETFB) is mapped to human chromosome 19q13.3. -
Add to Cart The item has been addedHPA018921-100ULANTI-ETFB (C15-1449-140)
Price: $959.88List Price: $1,066.53The gene electron transfer flavoprotein subunit β (ETFB) is mapped to human chromosome 19q13.3. -
Add to Cart The item has been addedHPA018923-100ULANTI-ETFB (C15-1449-141)
Price: $959.88List Price: $1,066.53The gene electron transfer flavoprotein subunit β (ETFB) is mapped to human chromosome 19q13.3. -
Add to Cart The item has been addedHPA055479-100ULANTI-GUCA1B
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to guanylate cyclase activator 1B Sequence GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA021032-100ULANTI-HSD17B1 (C15-1449-733)
Price: $959.88List Price: $1,066.53The gene HSD17B14 (17-β-hydroxysteroid dehydrogenase 14) is mapped to human chromosome 19q13.33. -
Add to Cart The item has been addedHPA021467-100ULANTI-HSD17B14 (C15-1449-878)
Price: $959.88List Price: $1,066.53The gene HSD17B14 (17-β-hydroxysteroid dehydrogenase 14) is mapped to human chromosome 19q13.33. -
Add to Cart The item has been addedHPA056833-100ULANTI-HSD17B3 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen hydroxysteroid (17-beta) dehydrogenase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA013162-100ULANTI-IL11RA ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Interleukin 11 receptor subunit alpha (IL11RA) gene has 13 exons. The protein has an extracellular, transmembrane and a cytoplasmic domain. -
Add to Cart The item has been addedHPA003980-100ULANTI-IL18 (C15-1446-121)
Price: $959.88List Price: $1,066.53Interleukin-18 (IL18) is a cofactor that belongs to the IL-1 family. It is expressed in many mammalian cells/tissues like liver, adipose tissue and skeletal muscle. -
Add to Cart The item has been addedHPA035302-100ULANTI-MAGIX (C15-1453-790)
Price: $1,013.20List Price: $1,125.78Immunogen MAGI family member, X-linked recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
