Basiliximab

The gene MDM4 (double minute 4 protein) is mapped to human chromosome 1q32. It belongs to MDM2 gene family and RING (really interesting new gene)-domain superfamily.

Immunogen methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to myelin transcription factor 1 like Sequence VNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

The gene NIPA1 (non-imprinted in Prader-Willi/Angelman syndrome 1) is mapped to human chromosome 15q11. The protein is predicted to have nine transmembrane segments.

ORC5 (Origin recognition complex subunit 5) is 50kDa protein encoding a subunit of the human origin recognition complex (ORC). It is located to chromosome 7q22.

Peroxisomal biogenesis factor 1 (PEX1) belongs to the ATPases associated with diverse cellular activities (AAA) family of proteins and possesses two ATPase domains. It has a molecular weight of 147kDa.

Immunogen peroxisomal biogenesis factor 16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Peroxisomal biogenesis factor 3 (PEX3) is a 373-amino-acid peroxisomal membrane protein with molecular weight of 42.1kDa.

The gene PHF20L1 (PHD finger protein 20-like 1) is mapped to human chromosome 8q24.22.

The gene PHF3 (PHD finger protein 3) is mapped to human chromosome 6. It is widely expressed in human tissues.

The gene PHF3 (PHD finger protein 3) is mapped to human chromosome 6. It is widely expressed in human tissues.

Immunogen paired-like homeobox 2a Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the