-
HPA025019-100UL
ANTI-ZNF114 (C15-1450-910)
Price: $959.88List Price: $1,066.53The gene ZNF114 (zinc finger protein 114) is mapped to human chromosome 19q13.2. -
HPA029553-100UL
ANTI-ZNF114 (C15-1452-314)
Price: $959.88List Price: $1,066.53The gene ZNF114 (zinc finger protein 114) is mapped to human chromosome 19q13.2. -
HPA009064-100UL
ANTI-ZNF134 (C15-1447-283)
Price: $959.88List Price: $1,066.53ZNF134 (zinc finger protein 134) gene is localized to human chromosome 19q13.4. -
HPA015322-100UL
ANTI-ZNF532 (C15-1448-336)
Price: $959.88List Price: $1,066.53Immunogen Zinc finger protein 532 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA077341-100UL
ANTI-ZNF536 (C15-1467-019)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to zinc finger protein 536 Sequence AFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPL Application All Prestige Antibodies Powered by Atlas Antibodies are -
EK712523
Human Glioma pathogenesis-related protein 1(GLIPR1) Elisa Kit
Price: $710.02List Price: $788.91Species : Human Assay Principle : Quantitative Target Name : Glioma pathogenesis-related protein 1 Sensitivity : 9.75 pg/ml Detection Range : 39 pg/ml-2500 pg/ml -
HUFI01895
Human GLIPR1/Glioma pathogenesis-related protein 1 ELISA Kit
Price: $1,587.38List Price: $1,763.75Human GLIPR1/Glioma pathogenesis-related protein 1 ELISA Kit -
IT3384
Immunotag Human GLIPR1 (Glioma pathogenesis-related protein 1) ELISA, 96 well plate
Price: $1,504.19List Price: $1,671.32An ELISA kit for the detection of GLIPR1 (Human). This uses Sandwich ELISA, Double Antibody and has a sensitivity of 18.75pg/ml. -
ITA8650-100u-555
Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 555* (C37-2166-698)
Price: $708.48List Price: $787.20Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 555* -
ITA8650-200u-555
Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 555* (C37-2166-708)
Price: $849.05List Price: $943.39Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 555* -
ITA8650-100u-647
Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 647* (C37-2166-700)
Price: $708.48List Price: $787.20Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 647* -
ITA8650-200u-647
Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 647* (C37-2166-710)
Price: $849.05List Price: $943.39Immunotag™ Cytochrome P450 2F1 Antibody-Alexa Fluor® 647*