Brucella antigen

Immunogen Antibody was raised against a 20 amino acid peptide near the amino terminus of human Bcl9L. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Bcl-2-associated transcription factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Bcl-2-associated transcription factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Synthetic peptide of human BCLAF1 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

General description Anti-BCLW Antibody detects endogenous levels of total BCLW protein. Immunogen The antiserum was produced against synthesized peptide derived from human BCLW.

BCMA (also known as Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, and CD269) is a receptor of BAFF. BCMA, like TACI, binds BAFF and April.

General description Anti-BCOR Antibody detects endogenous levels of total BCOR protein. Immunogen The antiserum was produced against synthesized peptide derived from human BCOR.

Bid, a BH3 domain-containing proapoptotic Bcl-2 family member, is known to interact with Bcl-2 and Bax. It has been reported that Bid induces cytochrome c release from mitochondria following cleavage by caspase-8 in response to apoptotic stimuli

Immunogen Synthetic peptide directed towards the C terminal of human BNC1 Sequence Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI Physical form Purified antibody supplied in 1x PBS

Specificity This antibody reacts to human BOB-1/OBF-1 (B-cell-specific coactivator) (POU domain class 2-associating factor 1). Immunogen A peptide corresponding to the C-terminus of human BOB-1/OBF-1 Physical form Solution in phosphate

Immunogen Peptide with sequence C-DAYALNHTLSVEGF from the C Terminus of the protein sequence according to NP_006226. Features and Benefits Evaluate our antibodies with complete peace of mind.

General description Anti-c-ErbB2/c-Neu (Ab-4), mouse monoclonal, clone 7.16.