Certolizumab

Cell Line Origin Mouse malignant mesothelioma Cell Line Description Mice (BALB/c female 6-8 weeks) were exposed to crocidolite asbestos through intraperitoneal injection resulting in tumour development. Cultures were established from malignant

Immunogen cerebellin 3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen cerebral cavernous malformation 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

General description CEACAM1 (carcinoembryonic antigen-related cell adhesion molecule 1) is thought to be a member of the immunoglobulin superfamily and is known as an epithelial tumor suppressor and an angiogenic growth factor. It has also been

Immunogen Synthetic peptide directed towards the N terminal region of human CEBPA Application Anti-CEBPA antibody produced in rabbit is suitable for western blotting at a concentration of 5 &#956g/ml. Biochem/physiol Actions CCAAT/enhancer binding

Immunogen CEBPZ (NP_005751.2, 1 a.

Immunogen Synthetic peptide directed towards the N terminal region of human CEBPZ Sequence Synthetic peptide located within the following region: MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGG Physical form Purified antibody supplied in 1x PBS

General description Anti-CEBPZ Antibody detects endogenous levels of total CEBPZ protein. Immunogen The antiserum was produced against synthesized peptide derived from human CEBPZ.

CUGBP Elav-like family member 5 (CELF5) belongs to CUG-BP, Elav-like family (CELF) family. It is highly expressed in brain.

Anti-CEP131 centrosomal protein 131kDa, 25ul UN 1687 6.1 PG2

Centrosomal protein 192 (CEP192) is a 192 kDa protein present in the centrosome. Cep192 is located on human chromosome 18p11.

Immunogen ceramide kinase-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by