Efalizumab

Rugged columns with internally threaded ends to which a wide choice of upper and lower end pieces can be fitted using 5837, 5838, 5841, 5842, and 5843 fittings. Available in a variety of lengths and diameters.

Rugged columns with internally threaded ends to which a wide choice of upper and lower end pieces can be fitted using 5837, 5838, 5841, 5842, and 5843 fittings. Available in a variety of lengths and diameters.

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

An inhibitor of the eIF4F translation initiation complex that inhibits cap-dependent translation with an IC₅₀ value of ~4 &muM reverses tumor chemoresistance in a mouse model of lymphoma by sensitizing cells to the proapoptotic action

An inhibitor of the eIF4F translation initiation complex that inhibits cap-dependent translation with an IC₅₀ value of ~4 &muM reverses tumor chemoresistance in a mouse model of lymphoma by sensitizing cells to the proapoptotic action

[KO VALIDATED]ANTI-EGFR ANTIBODY CLONE 3J1E3 RABBIT MONOCLONAL

A549 GFP-EGFR are lung carcinoma, epithelial cells from a human 58 year old male caucasion having a ZFN modification creating an EGFR-GFP transgene expressed from the endogenous EGFR gene locus. This cell line was derived from ATCC catalog No.

Anti-AES Antibody has been tested for use in ELISA, Immunocytochemistry, Immunofluorescence and Western Blotting. Specific conditions for reactivity should be optimized by the end user.

General description Anti-E2AK3 Antibody detects endogenous levels of total E2AK3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human E2AK3.

Immunogen Synthetic peptide directed towards the N terminal region of human E2F1 Sequence Synthetic peptide located within the following region: PARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWA Physical form Purified antibody supplied in 1x

ANTI-E2F1 ANTIBODY CLONE 5Z5U3 RABBIT MONOCLONAL

General description Anti-E2F1 Antibody detects endogenous levels of total E2F1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human E2F1.