-
HPA036949-100UL
ANTI-RAI14 (C15-1454-634)
Price: $1,013.20List Price: $1,125.78Immunogen retinoic acid induced 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA036950-100UL
ANTI-RAI14 (C15-1454-635)
Price: $1,013.20List Price: $1,125.78Immunogen retinoic acid induced 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA028285-100UL
ANTI-RBKS (C15-1451-770)
Price: $959.88List Price: $1,066.53Immunogen ribokinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA038860-100UL
ANTI-RBM19 (C15-1455-479)
Price: $1,013.20List Price: $1,125.78Immunogen RNA binding motif protein 19 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA043671-100UL
ANTI-RBM42 (C15-1457-814)
Price: $1,013.20List Price: $1,125.78Immunogen RNA binding motif protein 42 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027428-100UL
ANTI-RC3H1 (C15-1451-489)
Price: $959.88List Price: $1,066.53Immunogen ring finger and CCCH-type zinc finger domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA027434-100UL
ANTI-RC3H1 (C15-1451-492)
Price: $959.88List Price: $1,066.53Immunogen ring finger and CCCH-type zinc finger domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA027448-100UL
ANTI-RC3H1 (C15-1451-501)
Price: $959.88List Price: $1,066.53Immunogen ring finger and CCCH-type zinc finger domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA056384-100UL
ANTI-RGS19
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to regulator of G-protein signaling 19 Sequence PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA003050-100UL
ANTI-RHOJ (C15-1445-767)
Price: $959.88List Price: $1,066.53Immunogen ρ-Related GTP-binding protein RhoJ precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA077757-100UL
ANTI-RND2 (C15-1467-084)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to Rho family GTPase 2 Sequence GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA049587-100UL
ANTI-RNF19B ANTIBODY PRODUCED IN RABBIT (C15-1460-009)
Price: $1,013.20List Price: $1,125.78Immunogen ring finger protein 19B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported