-
Add to Cart The item has been addedITT4400-50u-BImmunotag™ SR-2C Polyclonal Antibody-Biotin* (C37-2393-691)
Price: $500.03List Price: $555.59Immunotag™ SR-2C Polyclonal Antibody-Biotin* -
Add to Cart The item has been addedITT4463-100u-555Immunotag™ Stonin-1 Polyclonal Antibody-Alexa Fluor® 555* (C37-2394-938)
Price: $708.48List Price: $787.20Immunotag™ Stonin-1 Polyclonal Antibody-Alexa Fluor® 555* -
Add to Cart The item has been addedITT4463-50u-555Immunotag™ Stonin-1 Polyclonal Antibody-Alexa Fluor® 555* (C37-2394-948)
Price: $500.03List Price: $555.59Immunotag™ Stonin-1 Polyclonal Antibody-Alexa Fluor® 555* -
Add to Cart The item has been addedITA2893-100u-555Immunotag™ TOM40 Antibody-Alexa Fluor® 555* (C37-2051-558)
Price: $708.48List Price: $787.20Immunotag™ TOM40 Antibody-Alexa Fluor® 555* -
Add to Cart The item has been addedITA2893-200u-555Immunotag™ TOM40 Antibody-Alexa Fluor® 555* (C37-2051-568)
Price: $849.05List Price: $943.39Immunotag™ TOM40 Antibody-Alexa Fluor® 555* -
Add to Cart The item has been added786-1210JAW™ Modified Dulbecco's PBS Packs (for ELISA and Western Blots)
Price: $226.80List Price: $252.00JAW™ Modified Dulbecco's PBS Packs (for ELISA and Western Blots) -
Add to Cart The item has been addedSAB4700913-100UGMONOCLONAL ANTI-CD144 ANTIBODY PRODUCED IN MOUSE
Price: $785.86List Price: $873.18General description The mouse monoclonal antibody 55-7H1 recognizes a calcium-independent epitope on CD144 (VE-cadherin, cadherin 5), an adhesion molecule expressed on endothelial cells. Immunogen Human endothelial cells Physical form Solution -
Add to Cart The item has been addedAMAB90883-100ULMONOCLONAL ANTI-CD8A ANTIBODY PRODUCED IN MOUSE (C15-1318-585)
Price: $1,066.53List Price: $1,185.03Immunogen Recombinant protein corresponding to CD8a molecule Sequence AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT Epitope Binds to an epitope located within the peptide sequence AASPTFLLYLSQNKP as determined -
Add to Cart The item has been addedWH0010294M1-100UGMONOCLONAL ANTI-DNAJA2 ANTIBODY PRODUCED IN MOUSE (C15-1688-101)
Price: $980.46List Price: $1,089.40General description The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct -
Add to Cart The item has been addedAMAB91480-100ULMONOCLONAL ANTI-FGF18 ANTIBODY PRODUCED IN MOUSE (C15-1318-875)
Price: $1,085.35List Price: $1,205.95Immunogen Recombinant protein corresponding to Fibroblast growth factor 18 Sequence QKPFKYTTVTKRSRRIRPT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedSAB1412468-100UGMONOCLONAL ANTI-GRK7 ANTIBODY PRODUCED IN MOUSE (C15-1745-844)
Price: $980.46List Price: $1,089.40General description This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has -
Add to Cart The item has been addedAMAB90893-100ULMONOCLONAL ANTI-OCLN ANTIBODY PRODUCED IN MOUSE (C15-1318-589)
Price: $1,066.53List Price: $1,185.03Immunogen occludin, recombinant protein epitope signature tag (PrEST) Sequence DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED Epitope Binds to an epitope
