Human papilloma virus vaccine

Immunogen phospholipase D1, phosphatidylcholine-specific Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen phospholipase D family, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen phospholipase D family, member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to phospholipid phosphatase related 5 Sequence PNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Phospholipid scramblase 4 (PLSCR4), a type II single-pass transmembrane protein, belongs to the scramblase family. The member of this family contains multiple PXXP (Proline rich) motifs and a PPXY (Proline-Proline-x–Tyrosine) motif located nea

Immunogen plexin A4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

PNMA1 (paraneoplastic Ma antigen 1) belongs to a new family of six members including, PNMA2, PNMA3, PNMA4 (also termed as MAP-1), PNMA5, PNMA6A. This is a family of “brain/testis” proteins which are linked with paraneoplastic neurological

PNMA2, a member of paraneoplastic Ma antigen (PNMA) gene family, is expressed in normal brain tissue (neocortex) but not in muscle cells. Its expression is upregulated in the testicular tumors.

Immunogen paraneoplastic Ma antigen family-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen patatin-like phospholipase domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen patatin-like phospholipase domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Patatin-like phospholipase domain-containing protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project