-
Add to Cart The item has been addedHPA020342-100ULANTI-CPA2 (C005B-205338)
Price: $959.88List Price: $1,066.53Carboxypeptidase A2 (CPA2) is formed by the release of the 81-residue activation domain of its proenzyme-procarboxypeptidase A2. Immunogen Carboxypeptidase A2 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige -
Add to Cart The item has been addedHPA076549-100ULANTI-CSDC2 (C005B-222110)
Price: $1,013.20List Price: $1,125.78Immunogen cold shock domain containing C2, RNA binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA066466-100ULANTI-CTDNEP1 (C005B-220331)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to CTD nuclear envelope phosphatase 1 Sequence QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA040394-100ULANTI-CTDP1 (C005B-211668)
Price: $1,013.20List Price: $1,125.78Immunogen CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA052607-100ULANTI-CTDSP2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA040763-100ULANTI-CTDSPL2 ANTIBODY PRODUCED IN RABBIT (C005B-211830)
Price: $1,013.20List Price: $1,125.78Immunogen CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA042949-100ULANTI-CYP2R1 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome P450, family 2, subfamily R, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA018670-100ULANTI-DHX58 (C005B-204853)
Price: $959.88List Price: $1,066.53The gene DHX58 (Probable ATP-dependent RNA helicase) is mapped to human chromosome 17q21.2. -
Add to Cart The item has been addedHPA008840-100ULANTI-DUSP12 (C005B-203136)
Price: $959.88List Price: $1,066.53DUSP12 (dual specificity phosphatase 12) gene is localized to human chromosome 1q21-q22. Its C-terminal contains a non-catalytic domain, which is rich in cysteine and acts as a zinc finger domain. -
Add to Cart The item has been addedHPA025812-100ULANTI-ELP3 (C005B-206682)
Price: $959.88List Price: $1,066.53The gene ELP3 (elongator complex protein 3) is mapped to human chromosome 8p21.1. -
Add to Cart The item has been addedHPA070816-100ULANTI-EMP2 ANTIBODY PRODUCED IN RABBIT (C005B-221142)
Price: $1,066.53List Price: $1,185.03Immunogen epithelial membrane protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA053643-100ULANTI-EPM2A ANTIBODY PRODUCED IN RABBIT (C005B-216743)
Price: $1,013.20List Price: $1,125.78Immunogen epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
