Human papilloma virus vaccine

Immunogen Recombinant protein corresponding to ETS variant 7 Sequence EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen TOG array regulator of axonemal microtubules 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen FYVE, RhoGEF and PH domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

General description Human parainfluenza virus type 3 (PI3 virus) causes mild to severe respiratory tract infection in infants. PI3 virus is an enveloped RNA virus and possesses two glycoproteins, hemagglutinin-neuraminidase (HN) and fusion (F), at

Immunogen FYVE and coiled-coil domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen GLI pathogenesis-related 1 like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen GLI pathogenesis-related 1 like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen golgi phosphoprotein 3 (coat-protein) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen H2A histone family, member Y2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen HAUS augmin-like complex, subunit 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen HAUS augmin-like complex, subunit 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Histone deacetylase 6 is an enzyme encoded by the HDAC6 gene in humans. It is a unique histone deacetylase because of its cytoplasmic localization and possession of two deacetylase domains and a ubiquitin-binding domain.