-
Add to Cart The item has been addedHPA050358-100ULANTI-LDLRAP1 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen low density lipoprotein receptor adaptor protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA003029-100ULANTI-LHFPL1 (C005B-201794)
Price: $959.88List Price: $1,066.53Immunogen Lipoma HMGIC fusion partner-like 1 protein precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA040249-100ULANTI-LIPT2 (C005B-211614)
Price: $1,013.20List Price: $1,125.78Immunogen lipoyl(octanoyl) transferase 2 (putative) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA017857-100ULANTI-LPIN2 (C005B-204617)
Price: $959.88List Price: $1,066.53Lipin 2 (LPIN2) belongs to the lipin family of enzymes. The gene encoding it is localized on chromosome 18. -
Add to Cart The item has been addedHPA074788-100ULANTI-LRP1B (C005B-221832)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to low density lipoprotein receptor-related protein 1B. Sequence IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA011934-100ULANTI-LRP4 (C005B-203554)
Price: $959.88List Price: $1,066.53Immunogen Low-density lipoprotein receptor-related protein 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA012300-100ULANTI-LRP4 (C005B-203625)
Price: $959.88List Price: $1,066.53Immunogen Low-density lipoprotein receptor-related protein 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA073031-100ULANTI-LRP8
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to LDL receptor related protein 8 Sequence HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA007270-100ULANTI-LSR (C005B-202788)
Price: $1,066.53List Price: $1,185.03Immunogen Lipolysis-stimulated lipoprotein receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA037005-100ULANTI-MAN2B2 (C005B-210207)
Price: $1,013.20List Price: $1,125.78Immunogen mannosidase, alpha, class 2B, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA053478-100ULANTI-MANBA ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen mannosidase, beta A, lysosomal recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedMABF2044ANTI-MCPYV LARGE T-ANTIGEN CLONE CM2B4 (C005B-450621)
Price: $751.40List Price: $834.89General description Merkel cells are neuroendocrine cells found in skin that have synaptic contacts with somatosensory afferents. These cells can turn malignant and form an aggressive form of skin cancer, which is known as Merkel cell carcinoma
