Immunosupressant peptides

Immunogen Peptide with sequence CKFDGAKGPAKVARKK, from the internal region (near C Terminus) of the protein sequence according to NP_005333.2.

Immunogen Synthetic peptide directed towards the N terminal region of human HMGCLL1 Sequence Synthetic peptide located within the following region: MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI Physical form Purified antibody supplied in

Immunogen Synthetic peptide from human HMGN1. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide of human HOXD1 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Specificity The antibody detects endogenous levels of total HRASLS2 protein. Immunogen Synthetic peptide corresponding to a region derived from internal residues of human HRAS-like suppressor 2 Features and Benefits Evaluate our antibodies

Immunogen HRASLS3 (AAH01387.1, 1 a.

Immunogen Peptide with sequence C-SHNSHKTSLRLNNS, from the internal region of the protein sequence according toNP_001124527.1: NP_071640.

General description Anti-HRH4 Antibody detects endogenous levels of total HRH4 protein. Immunogen The antiserum was produced against synthesized peptide derived from human HRH4.

Immunogen a 15 amino acid peptide from near the center of human Hrk. Linkage The action of this antibody can be blocked using blocking peptide SBP3771 .

Immunogen The immunogen for anti-HSP90AA1 antibody: synthetic peptide derected towards the C terminal of human HSP90AA1 Sequence Synthetic peptide located within the following region: STMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALL Physical

Immunogen A synthesized peptide derived from human HSPA14 Physical form Buffer: PBS with 0.02% sodium azide,0.

Immunogen The immunogen for anti-HSPA1A antibody: synthetic peptide derected towards the N terminal of human HSPA1A Sequence Synthetic peptide located within the following region: KMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINE Physical