Immunosupressant peptides

Immunogen Peptide with sequence DFTEEICRRVKDLD, from the C-terminal region of the protein sequence according toNP_005521.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence C-DHLKLHSYATSIRK, from the internal region of the protein sequence according toNP_004126.1: NP_777358.

Immunogen Peptide with sequence CKHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1.

Immunogen Synthetic peptide directed towards the middle region of human IER5L Sequence Synthetic peptide located within the following region: SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA Physical form Purified antibody supplied in 1x

General description This protein aggregates to form microtubular structures. Immunogen Synthetic peptide directed towards the middle region of human IFI44 Sequence Synthetic peptide located within the following region:

Specificity IFITM1 antibody will cross-react with other IFITM2 and IFITM3 proteins. Immunogen IFITM1 antibody was raised against a 16 amino acid peptide near the center of human IFITM1.

General description The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn

Immunogen Synthetic peptide directed towards the N terminal region of human IFT140 Biochem/physiol Actions IFT140 contains 9 TPR repeats and 5 WD repeats. Sequence Synthetic peptide located within the following region:

Specificity Recognizes C-terminus of IGF1 receptor Immunogen KLH-conjugated synthetic peptide encompassing the surrounding amino acids of the C-terminus in human IGF1 Application Anti-IGF1 Receptor (C-terminus) Antibody, clone 7G11 detects

Immunogen Synthetic peptide directed towards the middle region of human IGF2BP3 Biochem/physiol Actions Igf2bp3 is a RNA-binding protein that act as a regulator of mRNA translation and stability. Igf2bp3 binds to the 5&#8242:-UTR of the

General description IGFBP3 is a member of the insulin-like growth factor binding protein (IGFBP) family with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit

Immunogen Peptide with sequence C-RPQDVNRRDQQRNP from the internal region of the protein sequence according to NP_002169.1.