Immunosupressant peptides

General description IST1 is proposed to be involved in specific functions of the ESCRT machinery. It is required for efficient abscission during cytokinesis, but not for HIV-1 budding.

General description IST1 is proposed to be involved in specific functions of the ESCRT machinery. It is required for efficient abscission during cytokinesis, but not for HIV-1 budding.

General description IST1 is proposed to be involved in specific functions of the ESCRT machinery. It is required for efficient abscission during cytokinesis, but not for HIV-1 budding.

Immunogen Synthetic peptide directed towards the N terminal region of human ITGBL1 Biochem/physiol Actions ITGBL1 may be linked in some way with the evolution of the integrin beta subunits. Sequence Synthetic peptide located within the following

Immunogen Peptide with sequence ERLCVDPRHRQGPVN, from the internal region of the protein sequence according toNP_002209.2 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence C-RLLRQLAEIAESGL from the C Terminus of the protein sequence according to NP_005537. Features and Benefits Evaluate our antibodies with complete peace of mind.

General description Anti-ITPK1 Antibody detects endogenous levels of total ITPK1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ITPK1.

Immunogen Peptide with sequence CETERPKQKTEPDRSS, from the internal region of the protein sequence according to NP_079470.1.

Specificity The antibody detects endogenous levels of total ITPR3 protein. Immunogen Synthetic peptide corresponding to a region derived from internal residues of human inositol 1,4,5-trisphosphate receptor, type 3 Features and Benefits

Immunogen JMJD4 antibody was raised against a 17 amino acid peptide from near the amino terminus of human JMJD4. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the N terminal region of human JOSD2 Sequence Synthetic peptide located within the following region: QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA Physical form Purified antibody supplied in

Immunogen A synthetic peptide corresponding to a sequence containing polyubiquitinated protein (K63 linkage). Physical form Buffer: PBS with 0.