-
Add to Cart The item has been addedSAB2500550-100UGANTI-KALIRIN (ISOFORM 2) ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-RWHLGPGDPFSTYV from the C Terminus of the protein sequence according to NP_003938.1. -
Add to Cart The item has been addedSAB3500862-100UGANTI-KANK1 (N-TERMINAL) ANTIBODY PRODUCED IN RABBIT
Price: $963.62List Price: $1,070.69Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. -
Add to Cart The item has been addedSAB3500865-100UGANTI-KANK2 (C-TERMINAL) ANTIBODY PRODUCED IN RABBIT
Price: $963.62List Price: $1,070.69Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. -
Add to Cart The item has been addedSAB2500553-100UGANTI-KCC1/SLC12A4 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-DPSHAPDNFRE from the internal region of the protein sequence according to NP_005063.1. -
Add to Cart The item has been addedSAB4501390-100UGANTI-KCIP1 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-KCIP1 Antibody detects endogenous levels of total KCIP1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human KCIP1. -
Add to Cart The item has been addedSAB2501215-100UGANTI-KCNJ1 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence CDQININFVVDAGNEN , from the internal region of the protein sequence according to NP_000211.1: NP_722448. -
Add to Cart The item has been addedSAB4301621-100ULANTI-KCNK3
Price: $688.57List Price: $765.07Immunogen Synthetic peptide corresponding to residues near the C terminal of human potassium channel, subfamily K, member 3 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your -
Add to Cart The item has been addedSAB2501224-100UGANTI-KCNQ1 (C-TERMINAL) ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence CEQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2: NP_861463. -
Add to Cart The item has been addedSAB4501641-100UGANTI-KCNS2 ANTIBODY PRODUCED IN RABBIT (C15-1736-919)
Price: $946.78List Price: $1,051.98General description Anti-KCNS2 Antibody detects endogenous levels of total KCNS2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human KCNS2. -
Add to Cart The item has been addedSAB2501818-100UGANTI-KDM2A ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-PRKDRQVHLTHFELE, from the internal region of the protein sequence according toNP_036440.1 Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB2101239-100ULANTI-KDR
Price: $894.39List Price: $993.76Immunogen Synthetic peptide directed towards the N terminal region of human KDR Sequence Synthetic peptide located within the following region: LNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSD Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedSAB4501656-100UGANTI-KERATIN 10 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-Keratin 10 Antibody detects endogenous levels of total Keratin 10 protein. Immunogen The antiserum was produced against synthesized peptide derived from human Keratin 10.
