Immunosupressant peptides

General description Anti-Keratin 7 Antibody detects endogenous levels of total Keratin 7 protein. Immunogen The antiserum was produced against synthesized peptide derived from human Keratin 7.

Immunogen Synthetic peptide Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Immunogen Peptide with sequence C-KRPATDDSSTQNK from the internal region of the protein sequence according to NP_004055.1.

Immunogen The immunogen for anti-KIR2DL1 antibody: synthetic peptide derected towards the C terminal of human KIR2DL1 Sequence Synthetic peptide located within the following region: DEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRS Physical

Immunogen Peptide sequence around phosphorylation site of threonine 224 (K-T-TP-S-P) derived from Human Kir6.2.

General description Upon serum stimulation, KIS, a member of the Ser/Thr protein kinase family, phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. This protein, which contains 1 RRM

Immunogen Peptide with sequence KRDDAKYMYYLKK, from the internal region of the protein sequence according to NP_004786.2: NP_710150.

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

Immunogen Synthetic peptide directed towards the N terminal region of human KLF8 Biochem/physiol Actions KLF8 is abnormally expressed in female patients with X autosome translocation t(X:21)(p11.2:q22.

Immunogen Peptide with sequence VDMDKLINNLEVQ-C from the N Terminus of the protein sequence according to NP_009181.2.

Immunogen a 13 amino acid peptide near the carboxy-terminus of human KLRA1. Linkage The action of this antibody can be blocked using blocking peptide SBP4989 .

Immunogen a 13 amino acid peptide near the center of human KLRA1. Linkage The action of this antibody can be blocked using blocking peptide SBP4999 .