Immunosupressant peptides

Immunogen Synthetic peptide directed towards the N terminal region of human IL13RA2 Biochem/physiol Actions IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but

Immunogen Peptide with sequence CNPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1.

Immunogen synthetic peptide corresponding to amino acids 26-40 of human IL1F9 Physical form Solution in 0.01 M phosphate buffered saline, pH 7.

Immunogen The immunogen for anti-IL28B antibody: synthetic peptide derected towards the C terminal of human IL28B Sequence Synthetic peptide located within the following region: PRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDL Physical form

General description Purified rabbit polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

General description The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide

General description The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide

General description The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide

General description The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide

Immunogen Synthetic peptide directed towards the middle region of human ILDR1 Sequence Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV Physical form Purified antibody supplied in 1x

Immunogen Peptide with sequence DMIVPILEKMQDK, from the C-terminal region of the protein sequence according to NP_004508.1: NP_001014794.

General description Anti-ILK Antibody detects endogenous levels of total ILK protein. Immunogen The antiserum was produced against synthesized peptide derived from human ILK.