Immunosupressant peptides

General description Anti-LAMA2 Antibody detects endogenous levels of total LAMA2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human LAMA2.

General description Anti-LAMA3 Antibody detects endogenous levels of total LAMA3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human LAMA3.

LAMB2 (laminin subunit &#946 2) is a glycoprotein associated with synaptic basal lamina. It acts as a potent promoter of neurite outgrowth, and essential component of certain kidney membranes and basal laminae in the neuromuscular system.

General description Anti-LAMC3 Antibody detects endogenous levels of total LAMC3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human LAMC3.

General description Laminins are secreted glycoproteins, and are an important structural component of the extracellular matrix. The family of laminins is comprised of multiple isoforms, each formed from the oligomerization of various alpha, beta,

Immunogen Synthetic peptide directed towards the N terminal region of human LAP3 Sequence Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN Physical form Purified antibody supplied in 1x

Immunogen Peptide with sequence C-QGVLHIPKKDLTDE from the internal region of the protein sequence according to NP_060548.2.

Immunogen Synthetic peptide directed towards the C terminal region of human LARP7 Sequence Synthetic peptide located within the following region: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL Physical form Purified antibody supplied in 1x PBS

Immunogen Peptide with sequence CKDLREYDTAEAQ, from the internal region of the protein sequence according to NP_067090.1: NP_937850.

Immunogen a 13 amino acid peptide near the amino-terminus of the human LASS6. Linkage The action of this antibody can be blocked using blocking peptide SBP4941 .

Immunogen Peptide with sequence C-QYGTKVKHNSRLPKE from the C Terminus of the protein sequence according to NP_064554.2.

Immunogen Synthetic peptide directed towards the middle region of human LATS1 Sequence Synthetic peptide located within the following region: IPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLR Physical form Purified antibody supplied in 1x