Immunosupressant peptides

General description LBX1 is the transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm

Immunogen Peptide with sequence C-RNGSEVRDPLVTYE, from the internal region of the protein sequence according to NP_005347.3 Features and Benefits Evaluate our antibodies with complete peace of mind.

General description This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family

General description Anti-LEG4 Antibody detects endogenous levels of total LEG4 protein. Immunogen The antiserum was produced against synthesized peptide derived from human LEG4.

Immunogen Synthetic peptide directed towards the middle region of human LEMD2 Sequence Synthetic peptide located within the following region: SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human LEMD2 Sequence Synthetic peptide located within the following region: QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH Physical form Purified antibody supplied in 1x

ANTI-LEPTIN RECEPTOR ANTIBODY CLONE 6I0O4 RABBIT MONOCLONAL

Immunogen Synthetic peptide directed towards the N terminal region of human LETM2 Biochem/physiol Actions LETM2 contains 1 LETM1 domain. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the middle region of human LGALS1 Sequence Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM Physical form Purified antibody supplied in 1x

Immunogen Peptide with sequence KPGECLKVRGEVASD, from the near the N-terminal region of the protein sequence according to NP_032521.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence NANRIVLDFRRGND, from the internal region of the protein sequence according to NP_034835.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

LGALS8 (lectin, galactoside-binding, soluble, 8) encodes a protein that belongs to galectin family and is predominantly expressed in tumoral tissues and may be involved in integrin-like cell interactions. The previously assigned protein identifier