Immunosupressant peptides

Immunogen Synthetic peptide directed towards the C terminal region of human LHX6 Biochem/physiol Actions LHX6 is a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may

Immunogen Synthetic peptide directed towards the N terminal region of mouse Lhx8 Biochem/physiol Actions Lhx8 is a transcription factor involved in differentiation of certain neurons and mesenchymal cells. Sequence Synthetic peptide located

General description Anti-LIMK2 Antibody detects endogenous levels of total LIMK2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human LIMK2.

Immunogen Synthetic peptide directed towards the middle region of human LIN37 Sequence Synthetic peptide located within the following region: HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide of human LINGO1 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Immunogen Synthetic peptide directed towards the middle region of human LINGO4 Sequence Synthetic peptide located within the following region: TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human LOC253012 Sequence Synthetic peptide located within the following region: NYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEA Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human LPA Sequence Synthetic peptide located within the following region: VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human LPA Sequence Synthetic peptide located within the following region: SVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQDCY Physical form Purified antibody supplied in 1x PBS

Immunogen Peptide with sequence CKPKQKEDAVATD, from the internal region of the protein sequence according to NP_075047.1.

Immunogen Synthetic peptide directed towards the middle region of human LRP1 Sequence Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR Physical form Purified antibody supplied in 1x PBS

General description Anti-LRP3 Antibody detects endogenous levels of total LRP3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human LRP3.