Immunosupressant peptides

General description Anti-LTBR Antibody detects endogenous levels of total LTBR protein. Immunogen The antiserum was produced against synthesized peptide derived from human LTBR.

General description LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids,

General description LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids,

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

Immunogen Synthetic peptide directed towards the N terminal region of human LYPD4 Sequence Synthetic peptide located within the following region: MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human LYPLA2 Sequence Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP Physical form Purified antibody supplied in

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human M1-linkage Specific Polyubiquitin (NP_066289.3/NP_061828.

General description The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is

Immunogen a peptide corresponding to amino acids near the carboxy-terminus of human MADD. Linkage The action of this antibody can be blocked using blocking peptide SBP1150 .

Immunogen The immunogen for anti-MAF1 antibody: synthetic peptide derected towards the N terminal of human MAF1 Biochem/physiol Actions Maf1 is an element of the mTORC1 signaling pathway that acts as a mediator of diverse signals and that

Immunogen Synthetic peptide of human MAFA Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

General description Anti-MAFF (N-terminal) is developed in rabbit using a synthetic peptide corresponding to amino acids of human MAFF, conjugated to keyhole limpet hemocyanin (KLH) via a C-terminal added cysteine residue, as immunogen. The Maf