Immunosupressant peptides

Immunogen The immunogen for anti-MAFK antibody: synthetic peptide derected towards the N terminal of human MAFK Biochem/physiol Actions Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when

General description Anti-MAGEA5 Antibody detects endogenous levels of total MAGEA5 protein. Immunogen The antiserum was produced against synthesized peptide derived from human MAGEA5.

Immunogen Synthetic peptide of human MAGEA6 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Immunogen Synthetic peptide directed towards the N terminal region of human MAGEB2 Sequence Synthetic peptide located within the following region: MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA Physical form Purified antibody supplied in

Immunogen Peptide with sequence CSLIGLHFKIKPI, from the C Terminus of the protein sequence according to NP_002361.1.

Immunogen Peptide with sequence C-RPDNKEQTGQPLAK, from the internal region of the protein sequence according toXP_225927.5 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence VLPTCPMAEFALPR from the N Terminus of the protein sequence according to NP_055572.1.

Immunogen A synthesized peptide derived from human Mammaglobin A Physical form Buffer: PBS with 0.02% sodium azide,0.

Immunogen Synthetic peptide directed towards the N terminal of human MAN2A2 Sequence Synthetic peptide located within the following region: PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD Physical form Purified antibody supplied in 1x PBS

Immunogen MANF antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human MANF. Features and Benefits Evaluate our antibodies with complete peace of mind.

General description The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The

Immunogen Peptide with sequence CRAILAQRAGSTP, from the C-Terminus of the protein sequence according to NP_004663.3.