Immunosupressant peptides

Immunogen Peptide with sequence CRAILAQRAGSTP, from the C-Terminus of the protein sequence according to NP_004663.3.

Immunogen Synthetic peptide directed towards the N terminal region of human MAP7D1 Sequence Synthetic peptide located within the following region: RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ Physical form Purified antibody supplied in

General description ASAP is a microtubule-associated protein required for spindle function, mitotic progression, and cytokinesis. Immunogen Synthetic peptide directed towards the middle region of Human MAP9 Sequence Synthetic peptide located

Immunogen Synthetic peptide directed towards the C terminal of human MAPK12 Sequence Synthetic peptide located within the following region: ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the N terminal region of human MAPK12 Sequence Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE Physical form Purified antibody supplied in

General description MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.

Immunogen Peptide with sequence C-QNGKDSTAPQR from the internal region of the protein sequence according to NP_001034557.1: NP_001034558.

Immunogen MARVELD1 (NP_113672.1, 1 a.

Immunogen Synthetic peptide directed towards the middle region of human MASP2 Biochem/physiol Actions Masp2 is a serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation

Immunogen Synthetic peptide of human MATN2 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Specificity Reacts with reduced and non-reduced MMP-11. Recognizes active forms of MMP-11.

Immunogen Peptide with sequence STSHLAVCEFPI from the C Terminus of the protein sequence according to NP_000233. Features and Benefits Evaluate our antibodies with complete peace of mind.