Immunosupressant peptides

Immunogen Synthetic peptide directed towards the middle region of human MBP Sequence Synthetic peptide located within the following region: FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD Physical form Purified antibody supplied in 1x PBS

General description Anti-MCHR2 Antibody detects endogenous levels of total MCHR2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human MCHR2.

Immunogen a 14 amino acid peptide from near the carboxy-terminus of human MD-1. Linkage The action of this antibody can be blocked using blocking peptide SBP3847 .

Immunogen MAM domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST) Application Anti-MDGA2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project .

Immunogen Peptide with sequence C-DELSGERQRKRHKSD from the internal region of the protein sequence according to NP_002383.2.

General description Anti-MED1 Antibody detects endogenous levels of total MED1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human MED1.

Immunogen Synthetic peptide directed towards the N terminal region of human MED23 Biochem/physiol Actions The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in

Immunogen a 17 amino acid peptide from near the center of human MED28. Linkage The action of this antibody can be blocked using blocking peptide SBP4731 .

General description MED4 Antibody: The mediator complex is a multi-protein transcriptional co-activator that is expressed ubiquitously in eukaryotes from yeast to mammals and is required for induction of RNA polymerase II (pol II) transcription by

Immunogen Synthetic peptide directed towards the middle region of human MEMO1 Sequence Synthetic peptide located within the following region: AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH Physical form Purified antibody supplied in 1x

Immunogen Peptide with sequence KQQRKFQYGNYCK from the internal region of the protein sequence according to NP_062552.2.

Specificity Recognizes metabotropic glutamate receptor 1a (mGluR1a). On western blots of rat brain microsomes, the antibody labels a single band migrating at 140 kDa, corresponding to mGluR1alpha (Testa, 1998).