Immunosupressant peptides

Specificity Recognizes Metabotropic Glutamate Receptor 2 [mGluR2]. Immunogen Synthetic peptide from the N-terminal extracellular domain of human Metabotropic Glutamate Receptor 2.

Immunogen Synthetic peptide directed towards the middle region of human MFAP1 Sequence Synthetic peptide located within the following region: TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human MFN1 Sequence Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ Physical form Purified antibody supplied in 1x PBS

Immunogen MFSD1 antibody was raised against an 18 amino acid peptide near the center of human MFSD1. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen An 18 amino acid peptide near the carboxy terminus of human MFSD2A. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the N-terminal region of human MFSD2A Sequence Synthetic peptide located within the following region: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the N-terminal region of human MFSD2A Sequence Synthetic peptide located within the following region: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the N-terminal region of human MFSD2A Sequence Synthetic peptide located within the following region: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the N-terminal region of human MFSD2A Sequence Synthetic peptide located within the following region: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Physical form Supplied at 0.5 mg/ml in

Immunogen MFSD2B antibody was raised against a 15 amino acid peptide near the center of human MFSD2B. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence C-RPTTHPTNASHQ, from the internal region of the protein sequence according to NP_060164.3 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen The immunogen for anti-MGAT5B antibody: synthetic peptide derected towards the C terminal of human MGAT5B Sequence Synthetic peptide located within the following region: EGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAEN Physical