-
Add to Cart The item has been addedSAB2107571-100ULANTI-MIA2 (C15-1743-995)
Price: $963.62List Price: $1,070.69Immunogen Synthetic peptide directed towards the C terminal region of human MIA2 Sequence Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedAV44247-100ULANTI-MICA
Price: $828.90List Price: $921.00Immunogen Synthetic peptide directed towards the middle region of human MICA Application Anti-MICA antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. -
Add to Cart The item has been addedPRS4261-100UGANTI-MICA ANTIBODY PRODUCED IN RABBIT (C15-1849-159)
Price: $980.46List Price: $1,089.40Immunogen a 16 amino acid peptide from near the carboxy-terminus of human MICA. Linkage The action of this antibody can be blocked using blocking peptide SBP4261 . -
Add to Cart The item has been addedSAB2106339-100ULANTI-MID2
Price: $963.62List Price: $1,070.69Immunogen Synthetic peptide directed towards the N terminal of human MID2 Sequence Synthetic peptide located within the following region: ASLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHE Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedSAB2500636-100UGANTI-MKIAA0319 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-QGKIKQENKPTLH from the internal region of the protein sequence according to NP_001074520.1. -
Add to Cart The item has been addedSAB2101483-100ULANTI-MKNK2
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human MKNK2 Application Anti-MKNK2 antibody produced in rabbit is suitable for western blot analysis. Sequence Synthetic peptide located within the following region: -
Add to Cart The item has been addedSAB4500676-100UGANTI-MKP-1 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-MKP-1 Antibody detects endogenous levels of total MKP-1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human MKP-1/2. -
Add to Cart The item has been addedSAB2501717-100UGANTI-MKRN1 ANTIBODY PRODUCED IN GOAT (C15-1742-022)
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-RYEHSKPLKQEEAT, from the internal region of the protein sequence according toNP_038474.2: NP_001138597. -
Add to Cart The item has been addedSAB3500651-100UGANTI-MLIP ANTIBODY PRODUCED IN RABBIT (C15-1740-985)
Price: $963.62List Price: $1,070.69Immunogen Antibody was raised against a 16 amino acid peptide near the carboxy terminus of human MLIP. Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB4501882-100UGANTI-MLK1 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-MLK1 Antibody detects endogenous levels of total MLK1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human MLK1/2. -
Add to Cart The item has been addedSAB2104303-100ULANTI-MLXIP (C15-1744-595)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human MLXIP Biochem/physiol Actions MONDOA forms heterodimers with MLX (MIM 602976) that can bind to and activate transcription from CACGTG E boxes. Sequence Synthetic peptide -
Add to Cart The item has been addedSAB4501892-100UGANTI-MMP-3 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-MMP-3 Antibody detects endogenous levels of total MMP-3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human MMP-3.
