Immunosupressant peptides

Immunogen Synthetic peptide directed towards the middle region of human MMP13 Sequence Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the C terminal region of human MMP2 Sequence Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL Physical form Purified antibody supplied in 1x

Immunogen Peptide with sequence C-QKLYGKRSNSRKK from the C Terminus of the protein sequence according to NP_002414.1.

Immunogen Peptide with sequence KESAAHILNRK, from the internal region of the protein sequence according to NP_079374.2 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence RPLKTIYYTGPNE, from the internal region of the protein sequence according to NP_115731.2: NP_001135973.

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Monkey IgM coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis

Immunogen The immunogen for anti-MORN4 antibody: synthetic peptide derected towards the C terminal of human MORN4 Sequence Synthetic peptide located within the following region: GFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAVVQRAQSASKSARNLT Physical form

Immunogen Synthetic peptide directed towards the middle region of human MOSPD2 Sequence Synthetic peptide located within the following region: TPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST Physical form Purified antibody supplied in 1x

General description G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. Northern analyses revealed GPR81 expression in the pituitary.

General description G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. Northern analyses revealed GPR81 expression in the pituitary.

General description Pcp2 may function as a cell-type specific modulator for G protein-mediated cell signaling. This protein exhibits tissue specificity for cerebellum (Purkinje cells) and retinal bipolar neurons.

Immunogen Peptide sequence around aa. 16-20 (A-T-S-N-V), according to the protein MRCL3.