Immunosupressant peptides

Immunogen Synthetic peptide directed towards the middle region of human MTMR12 Sequence Synthetic peptide located within the following region: RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD Physical form Purified antibody supplied in 1x

Immunogen Peptide with sequence CSLKYDKLYSSKNS, from the internal region of the protein sequence according to NP_005949.1.

General description Anti-MTOR Antibody detects endogenous levels of total MTOR protein. Immunogen The antiserum was produced against synthesized peptide derived from human mTOR.

Immunogen Peptide with sequence ECKRSVKYNYETFQ, from the C-terminal region of the protein sequence according to NP_997126.2 Features and Benefits Evaluate our antibodies with complete peace of mind.

General description Mucolipin-3 (MLN3) belongs to mucolipin subfamily. It consists of six transmembrane domain (TMD), with a putative pore region between TMD5 and TMD6 and cytosolic N- and C-termini.

Specificity This antibody reacts to human MUM1/IRF4 (Interferon regulatory factor 4). Immunogen A peptide corresponding to the C-terminus of human MUM1/IRF4.

Immunogen Peptide with sequence C-HISTDAHSLNSAAQ from the C Terminus of the protein sequence according to NP_036354.1: NP_001041636.

Immunogen Synthetic peptide directed towards the N terminal region of human MVP Sequence Synthetic peptide located within the following region: MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the C terminal of human Mxd1 Sequence Synthetic peptide located within the following region: TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ Physical form Purified antibody supplied in 1x PBS

Immunogen The immunogen for anti-MXD1 antibody: synthetic peptide derected towards the C terminal of human MXD1 Sequence Synthetic peptide located within the following region: VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV Physical form

Immunogen Peptide with sequence QEHSYSHGGGAWL, from the C-terminal region of the protein sequence according to NP_112590.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the N terminal region of human MYBL2 Sequence Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK Physical form Purified antibody supplied in